PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G29400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 333aa    MW: 36646.1 Da    PI: 6.9631
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G29400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.92.3e-102502832255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yps++e++ LA+++gL+++qV++WF N+R ++
  OGLUM03G29400.1 250 WPYPSEAEKAALAESTGLDKKQVTNWFINQRKRH 283
                      58*****************************885 PP

2ELK33.49.6e-12203222322
              ELK   3 KhqLlrKYsgyLgsLkqEFs 22 
                      +++L++KYsgyL+sL++E+s
  OGLUM03G29400.1 203 RRHLMNKYSGYLNSLWTEIS 222
                      79*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-1965109IPR005540KNOX1
PfamPF037901.1E-1967103IPR005540KNOX1
SMARTSM012561.2E-27119170IPR005541KNOX2
PfamPF037911.1E-21123168IPR005541KNOX2
PROSITE profilePS512138.783201221IPR005539ELK domain
SMARTSM011887.8E-4201222IPR005539ELK domain
PfamPF037894.0E-8203222IPR005539ELK domain
PROSITE profilePS5007112.034223286IPR001356Homeobox domain
SMARTSM003892.1E-12225290IPR001356Homeobox domain
SuperFamilySSF466896.42E-18225294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-25230287IPR009057Homeodomain-like
CDDcd000863.60E-13232287No hitNo description
PfamPF059206.9E-17243282IPR008422Homeobox KN domain
PROSITE patternPS000270261284IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEQLHLLLAS GGGSKASTTI TPFCLARDHA STSSPSPAAV AAPAPPPEAE QSIHGSGTGL  60
QSSEAMIKAK IMSHPLYPSL LRAFVDCKKV GAPPEVVGRL SSLAVVTDVP QYSGDRWLPA  120
QQPAADPELD QFMETYCYML TRYGQELARP IQEAEEFFRG IEEQIDSLAL DEDVSYDYED  180
EVAGGLPEKS AAFGENEVTT TRRRHLMNKY SGYLNSLWTE ISNKKKNSTG HLPRDARHKL  240
LQWWHLHYRW PYPSEAEKAA LAESTGLDKK QVTNWFINQR KRHWKPKPAA AMDAGFLQMH  300
PRYGASSSSS PAAALRVEDG GGGRSAYHPR GGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6950040.0HQ695004.1 Oryza sativa fused compound leaf 2 (FCL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629612.10.0PREDICTED: putative homeobox protein knotted-1-like 5
SwissprotQ75LX90.0KNOS5_ORYSJ; Putative homeobox protein knotted-1-like 5
TrEMBLA0A0D9ZBG10.0A0A0D9ZBG1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010071-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-65KNOTTED-like from Arabidopsis thaliana